Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for drjr 41. drjr Lv 1 8 pts. 9,557
  2. Avatar for SemperRabbit 42. SemperRabbit Lv 1 7 pts. 9,548
  3. Avatar for drumpeter18yrs9yrs 43. drumpeter18yrs9yrs Lv 1 7 pts. 9,533
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 6 pts. 9,479
  5. Avatar for heather-1 45. heather-1 Lv 1 6 pts. 9,468
  6. Avatar for vuvuvu 46. vuvuvu Lv 1 5 pts. 9,462
  7. Avatar for Artoria2e5 47. Artoria2e5 Lv 1 5 pts. 9,457
  8. Avatar for Alistair69 48. Alistair69 Lv 1 4 pts. 9,443
  9. Avatar for ProfVince 49. ProfVince Lv 1 4 pts. 9,438
  10. Avatar for mibrammall 50. mibrammall Lv 1 4 pts. 9,434

Comments