Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for jamestpierce 51. jamestpierce Lv 1 3 pts. 9,419
  2. Avatar for Trajan464 52. Trajan464 Lv 1 3 pts. 9,407
  3. Avatar for sitlux 53. sitlux Lv 1 3 pts. 9,395
  4. Avatar for Steven Pletsch 54. Steven Pletsch Lv 1 3 pts. 9,370
  5. Avatar for Th1sN@me!sN0tAPun 55. Th1sN@me!sN0tAPun Lv 1 2 pts. 9,349
  6. Avatar for dy9110 56. dy9110 Lv 1 2 pts. 9,348
  7. Avatar for JackONeill12 57. JackONeill12 Lv 1 2 pts. 9,345
  8. Avatar for abiogenesis 58. abiogenesis Lv 1 2 pts. 9,344
  9. Avatar for rosie4loop 59. rosie4loop Lv 1 2 pts. 9,342
  10. Avatar for carxo 60. carxo Lv 1 1 pt. 9,325

Comments