Icon representing a puzzle

2382: Revisiting Puzzle 117: Transport Mutant

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,582
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,479
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,462
  4. Avatar for 202302 14. 202302 1 pt. 9,348
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 9,288
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 4,127
  1. Avatar for BrittanyBird 61. BrittanyBird Lv 1 1 pt. 9,319
  2. Avatar for Merf 62. Merf Lv 1 1 pt. 9,314
  3. Avatar for zbp 63. zbp Lv 1 1 pt. 9,308
  4. Avatar for Dr.Sillem 64. Dr.Sillem Lv 1 1 pt. 9,307
  5. Avatar for hada 65. hada Lv 1 1 pt. 9,288
  6. Avatar for AlphaFold2 66. AlphaFold2 Lv 1 1 pt. 9,288
  7. Avatar for Arne Heessels 67. Arne Heessels Lv 1 1 pt. 9,263
  8. Avatar for Oransche 68. Oransche Lv 1 1 pt. 9,160
  9. Avatar for Diumberm 69. Diumberm Lv 1 1 pt. 9,157
  10. Avatar for DScott 70. DScott Lv 1 1 pt. 9,115

Comments