Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,071
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 11,053
  3. Avatar for Aubade01 3. Aubade01 Lv 1 90 pts. 10,969
  4. Avatar for akaaka 4. akaaka Lv 1 86 pts. 10,963
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 81 pts. 10,890
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 77 pts. 10,888
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 72 pts. 10,882
  8. Avatar for Galaxie 8. Galaxie Lv 1 68 pts. 10,880
  9. Avatar for grogar7 9. grogar7 Lv 1 65 pts. 10,866
  10. Avatar for blazegeek 10. blazegeek Lv 1 61 pts. 10,842

Comments