Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,071
  2. Avatar for Go Science 2. Go Science 71 pts. 11,053
  3. Avatar for Contenders 3. Contenders 49 pts. 10,835
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,834
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,829
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,683
  7. Avatar for Cancer Blasters! 7. Cancer Blasters! 8 pts. 10,648
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 10,635
  9. Avatar for Australia 9. Australia 3 pts. 10,628
  10. Avatar for VeFold 10. VeFold 2 pts. 10,581
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,071
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 11,053
  3. Avatar for Aubade01 3. Aubade01 Lv 1 90 pts. 10,969
  4. Avatar for akaaka 4. akaaka Lv 1 86 pts. 10,963
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 81 pts. 10,890
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 77 pts. 10,888
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 72 pts. 10,882
  8. Avatar for Galaxie 8. Galaxie Lv 1 68 pts. 10,880
  9. Avatar for grogar7 9. grogar7 Lv 1 65 pts. 10,866
  10. Avatar for blazegeek 10. blazegeek Lv 1 61 pts. 10,842

Comments