Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165
  1. Avatar for dipeyez 91. dipeyez Lv 1 1 pt. 8,165
  2. Avatar for blrex 92. blrex Lv 1 1 pt. 8,165
  3. Avatar for jjangdol 93. jjangdol Lv 1 1 pt. 8,165
  4. Avatar for AY2023_24_S1_PLMCHM33151_BLK1G1 94. AY2023_24_S1_PLMCHM33151_BLK1G1 Lv 1 1 pt. 8,165
  5. Avatar for drjr 95. drjr Lv 1 1 pt. 8,165

Comments