Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165

  1. Avatar for heather-1 31. heather-1 Lv 1 15 pts. 10,513
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 14 pts. 10,489
  3. Avatar for roarshock 33. roarshock Lv 1 13 pts. 10,487
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 12 pts. 10,470
  5. Avatar for Larini 35. Larini Lv 1 11 pts. 10,439
  6. Avatar for alcor29 36. alcor29 Lv 1 10 pts. 10,426
  7. Avatar for phi16 37. phi16 Lv 1 9 pts. 10,405
  8. Avatar for AmaralMo 38. AmaralMo Lv 1 9 pts. 10,356
  9. Avatar for carsonfb 39. carsonfb Lv 1 8 pts. 10,342
  10. Avatar for ecali 40. ecali Lv 1 7 pts. 10,337

Comments