Icon representing a puzzle

2387: Revisiting Puzzle 124: PDZ Domain

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,470
  2. Avatar for 202302 12. 202302 1 pt. 10,055
  3. Avatar for Team China 13. Team China 1 pt. 9,871
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,626
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,341
  6. Avatar for Haykapnayan 16. Haykapnayan 1 pt. 8,165
  1. Avatar for Oransche 61. Oransche Lv 1 1 pt. 9,876
  2. Avatar for lezhe 62. lezhe Lv 1 1 pt. 9,871
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 1 pt. 9,844
  4. Avatar for Steven Pletsch 64. Steven Pletsch Lv 1 1 pt. 9,800
  5. Avatar for CDSoffice 65. CDSoffice Lv 1 1 pt. 9,784
  6. Avatar for nancy_naniewoo 66. nancy_naniewoo Lv 1 1 pt. 9,764
  7. Avatar for rinze 67. rinze Lv 1 1 pt. 9,662
  8. Avatar for Th1sN@me!sN0tAPun 68. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,645
  9. Avatar for carxo 69. carxo Lv 1 1 pt. 9,640
  10. Avatar for Savas 70. Savas Lv 1 1 pt. 9,626

Comments