Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,978
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,582
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,544
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 9,231
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 8,856
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,344
  1. Avatar for akaaka 21. akaaka Lv 1 25 pts. 10,095
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 23 pts. 10,089
  3. Avatar for hansvandenhof 23. hansvandenhof Lv 1 21 pts. 10,072
  4. Avatar for Joanna_H 24. Joanna_H Lv 1 20 pts. 10,072
  5. Avatar for jausmh 25. jausmh Lv 1 18 pts. 10,056
  6. Avatar for alcor29 26. alcor29 Lv 1 17 pts. 10,051
  7. Avatar for maithra 27. maithra Lv 1 15 pts. 10,043
  8. Avatar for gmn 28. gmn Lv 1 14 pts. 10,022
  9. Avatar for ShadowTactics 29. ShadowTactics Lv 1 13 pts. 10,020
  10. Avatar for roarshock 30. roarshock Lv 1 12 pts. 10,011

Comments