Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,214
  2. Avatar for Go Science 2. Go Science 71 pts. 10,137
  3. Avatar for Contenders 3. Contenders 49 pts. 10,135
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,130
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,089
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,072
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,020
  9. Avatar for Australia 9. Australia 3 pts. 10,001
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,988

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,214
  2. Avatar for Aubade01 2. Aubade01 Lv 1 95 pts. 10,180
  3. Avatar for blazegeek 3. blazegeek Lv 1 89 pts. 10,172
  4. Avatar for BackBuffer 4. BackBuffer Lv 1 83 pts. 10,158
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 78 pts. 10,156
  6. Avatar for Galaxie 6. Galaxie Lv 1 74 pts. 10,151
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 69 pts. 10,139
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 65 pts. 10,137
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 60 pts. 10,136
  10. Avatar for MicElephant 10. MicElephant Lv 1 56 pts. 10,135

Comments