Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,978
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,582
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,544
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 9,231
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 8,856
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,344
  1. Avatar for AlkiP0Ps 31. AlkiP0Ps Lv 1 11 pts. 10,001
  2. Avatar for Simek 32. Simek Lv 1 10 pts. 9,988
  3. Avatar for Hillbillie 33. Hillbillie Lv 1 9 pts. 9,978
  4. Avatar for vybi 34. vybi Lv 1 8 pts. 9,960
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 7 pts. 9,948
  6. Avatar for Steven Pletsch 36. Steven Pletsch Lv 1 7 pts. 9,937
  7. Avatar for georg137 37. georg137 Lv 1 6 pts. 9,929
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 5 pts. 9,920
  9. Avatar for ecali 39. ecali Lv 1 5 pts. 9,883
  10. Avatar for Larini 40. Larini Lv 1 4 pts. 9,874

Comments