Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,978
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,582
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,544
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 9,231
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 8,856
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,344

  1. Avatar for abiogenesis 51. abiogenesis Lv 1 1 pt. 9,657
  2. Avatar for blrex 52. blrex Lv 1 1 pt. 9,646
  3. Avatar for goldfish80 53. goldfish80 Lv 1 1 pt. 9,641
  4. Avatar for kitsoune 54. kitsoune Lv 1 1 pt. 9,609
  5. Avatar for Arne Heessels 55. Arne Heessels Lv 1 1 pt. 9,609
  6. Avatar for Guido 56. Guido Lv 1 1 pt. 9,582
  7. Avatar for Deleted player 57. Deleted player 1 pt. 9,553
  8. Avatar for alyssa_d_V2.0 58. alyssa_d_V2.0 Lv 1 1 pt. 9,544
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 9,501
  10. Avatar for SaraL 60. SaraL Lv 1 1 pt. 9,493

Comments