Icon representing a puzzle

2390: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,978
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,582
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,544
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 9,231
  5. Avatar for Street Smarts 15. Street Smarts 1 pt. 8,856
  6. Avatar for AlphaFold 16. AlphaFold 1 pt. 8,344

  1. Avatar for carxo 61. carxo Lv 1 1 pt. 9,467
  2. Avatar for phi16 62. phi16 Lv 1 1 pt. 9,418
  3. Avatar for silent gene 63. silent gene Lv 1 1 pt. 9,355
  4. Avatar for Mohoernchen 64. Mohoernchen Lv 1 1 pt. 9,349
  5. Avatar for Dr.Sillem 65. Dr.Sillem Lv 1 1 pt. 9,302
  6. Avatar for HavocOrder0999 66. HavocOrder0999 Lv 1 1 pt. 9,299
  7. Avatar for rinze 67. rinze Lv 1 1 pt. 9,291
  8. Avatar for poltix 68. poltix Lv 1 1 pt. 9,231
  9. Avatar for jtwolff 69. jtwolff Lv 1 1 pt. 9,226
  10. Avatar for ProteinGujo 70. ProteinGujo Lv 1 1 pt. 9,092

Comments