Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,291
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,569
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 7,712
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Die Bigbrains 16. Die Bigbrains 1 pt. 2,801
  1. Avatar for zbp 51. zbp Lv 1 1 pt. 8,440
  2. Avatar for Opelgang 52. Opelgang Lv 1 1 pt. 8,394
  3. Avatar for Arne Heessels 53. Arne Heessels Lv 1 1 pt. 8,276
  4. Avatar for Hexafluorouranate 54. Hexafluorouranate Lv 1 1 pt. 8,223
  5. Avatar for Oransche 55. Oransche Lv 1 1 pt. 8,171
  6. Avatar for PatrikStar24 56. PatrikStar24 Lv 1 1 pt. 8,030
  7. Avatar for 2284503 57. 2284503 Lv 1 1 pt. 7,712
  8. Avatar for jdmclure 58. jdmclure Lv 1 1 pt. 7,593
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 7,454
  10. Avatar for drumpeter18yrs9yrs 60. drumpeter18yrs9yrs Lv 1 1 pt. 7,317

Comments