Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,291
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,569
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 7,712
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Die Bigbrains 16. Die Bigbrains 1 pt. 2,801
  1. Avatar for ece_cinar 61. ece_cinar Lv 1 1 pt. 7,106
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 7,084
  3. Avatar for mart0258 63. mart0258 Lv 1 1 pt. 6,983
  4. Avatar for goksukus 64. goksukus Lv 1 1 pt. 6,161
  5. Avatar for KofiO 65. KofiO Lv 1 1 pt. 5,756
  6. Avatar for threedylan 66. threedylan Lv 1 1 pt. 5,689
  7. Avatar for mere rhetoric 67. mere rhetoric Lv 1 1 pt. 3,711
  8. Avatar for Francisco 68. Francisco Lv 1 1 pt. 3,635
  9. Avatar for spvincent 69. spvincent Lv 1 1 pt. 2,801
  10. Avatar for agcohn821 70. agcohn821 Lv 1 1 pt. 2,801

Comments