Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 47,059
  2. Avatar for Team China 12. Team China 1 pt. 45,670
  3. Avatar for 202302 13. 202302 1 pt. 45,665
  1. Avatar for phi16 11. phi16 Lv 1 50 pts. 47,880
  2. Avatar for alcor29 12. alcor29 Lv 1 47 pts. 47,880
  3. Avatar for blazegeek 13. blazegeek Lv 1 43 pts. 47,860
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 40 pts. 47,820
  5. Avatar for gmn 15. gmn Lv 1 37 pts. 47,803
  6. Avatar for akaaka 16. akaaka Lv 1 34 pts. 47,787
  7. Avatar for jausmh 17. jausmh Lv 1 32 pts. 47,771
  8. Avatar for fpc 18. fpc Lv 1 29 pts. 47,769
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 27 pts. 47,764
  10. Avatar for ichwilldiesennamen 20. ichwilldiesennamen Lv 1 25 pts. 47,731

Comments