Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 47,059
  2. Avatar for Team China 12. Team China 1 pt. 45,670
  3. Avatar for 202302 13. 202302 1 pt. 45,665
  1. Avatar for ProfVince 41. ProfVince Lv 1 3 pts. 46,915
  2. Avatar for drumpeter18yrs9yrs 42. drumpeter18yrs9yrs Lv 1 3 pts. 46,673
  3. Avatar for Hellcat6 43. Hellcat6 Lv 1 3 pts. 46,553
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 2 pts. 46,475
  5. Avatar for georg137 45. georg137 Lv 1 2 pts. 46,369
  6. Avatar for Oransche 46. Oransche Lv 1 2 pts. 46,367
  7. Avatar for maithra 47. maithra Lv 1 2 pts. 46,366
  8. Avatar for pfirth 48. pfirth Lv 1 2 pts. 46,092
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 46,039
  10. Avatar for silent gene 50. silent gene Lv 1 1 pt. 46,017

Comments