Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 47,059
  2. Avatar for Team China 12. Team China 1 pt. 45,670
  3. Avatar for 202302 13. 202302 1 pt. 45,665
  1. Avatar for JackONeill12 51. JackONeill12 Lv 1 1 pt. 45,997
  2. Avatar for Opelgang 52. Opelgang Lv 1 1 pt. 45,989
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 45,940
  4. Avatar for jamestpierce 54. jamestpierce Lv 1 1 pt. 45,906
  5. Avatar for pruneau_44 55. pruneau_44 Lv 1 1 pt. 45,873
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 45,872
  7. Avatar for jdmclure 57. jdmclure Lv 1 1 pt. 45,860
  8. Avatar for koolcoder101 58. koolcoder101 Lv 1 1 pt. 45,820
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 1 pt. 45,814
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 45,774

Comments