Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Belgium 11. Belgium 1 pt. 47,059
  2. Avatar for Team China 12. Team China 1 pt. 45,670
  3. Avatar for 202302 13. 202302 1 pt. 45,665
  1. Avatar for Dr.Sillem 61. Dr.Sillem Lv 1 1 pt. 45,774
  2. Avatar for osc 62. osc Lv 1 1 pt. 45,736
  3. Avatar for carxo 63. carxo Lv 1 1 pt. 45,732
  4. Avatar for harvardman 64. harvardman Lv 1 1 pt. 45,717
  5. Avatar for lezhe 65. lezhe Lv 1 1 pt. 45,670
  6. Avatar for dy9110 66. dy9110 Lv 1 1 pt. 45,665
  7. Avatar for Yechan Kwon 67. Yechan Kwon Lv 1 1 pt. 45,645
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 45,534
  9. Avatar for drjr 69. drjr Lv 1 1 pt. 45,423
  10. Avatar for froschi2 70. froschi2 Lv 1 1 pt. 45,197

Comments