Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 36,031
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,951
  3. Avatar for 202302 13. 202302 1 pt. 35,261
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 34,396
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 37,199
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 37,177
  3. Avatar for gmn 3. gmn Lv 1 89 pts. 37,167
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 83 pts. 37,162
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 78 pts. 37,116
  6. Avatar for MicElephant 6. MicElephant Lv 1 73 pts. 37,086
  7. Avatar for blazegeek 7. blazegeek Lv 1 68 pts. 37,081
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 64 pts. 37,069
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 60 pts. 37,056
  10. Avatar for Steven Pletsch 10. Steven Pletsch Lv 1 56 pts. 37,049

Comments