Artoria2e5 Lv 1
https://www.rcsb.org/structure/1BG8, asymmetric unit. Also check out https://www.rcsb.org/structure/1DJ8 asymmetric unit – the protein did it again!
2380:Electron Density Reconstruction 66
Closed since over 2 years ago
Novice Overall Prediction Electron DensitySummary
- Created
- November 13, 2023
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.
- Sequence
- ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM