Placeholder image of a protein
Icon representing a puzzle

2380:Electron Density Reconstruction 66

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 13, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are three chains in this puzzle of the same sequence, but not all the segments may be visible in the density. One of the chains will appear to be separated from the others, but this is actually a trick of the crystal symmtery.

Sequence
ADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 37,207
  2. Avatar for Go Science 2. Go Science 68 pts. 37,177
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 37,162
  4. Avatar for Contenders 4. Contenders 27 pts. 37,086
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 36,929
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 36,891
  7. Avatar for Australia 7. Australia 5 pts. 36,824
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 36,620
  9. Avatar for Ukraine 9. Ukraine 1 pt. 36,247
  10. Avatar for Belgium 10. Belgium 1 pt. 36,177
  1. Avatar for Yechan Kwon 71. Yechan Kwon Lv 1 1 pt. 34,989
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 1 pt. 34,901
  3. Avatar for JackONeill12 73. JackONeill12 Lv 1 1 pt. 34,826
  4. Avatar for osc 74. osc Lv 1 1 pt. 34,776
  5. Avatar for vuvuvu 75. vuvuvu Lv 1 1 pt. 34,396
  6. Avatar for Yusil 76. Yusil Lv 1 1 pt. 33,632
  7. Avatar for adolf zitler 77. adolf zitler Lv 1 1 pt. 31,670
  8. Avatar for when 78. when Lv 1 1 pt. 27,384
  9. Avatar for yungachat 79. yungachat Lv 1 1 pt. 27,224
  10. Avatar for Rene3527 80. Rene3527 Lv 1 1 pt. 27,224

Comments