Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 30,141

  1. Avatar for manu8170 31. manu8170 Lv 1 4 pts. 33,710
  2. Avatar for RichGuilmain 32. RichGuilmain Lv 1 4 pts. 33,600
  3. Avatar for ShadowTactics 33. ShadowTactics Lv 1 3 pts. 33,479
  4. Avatar for carsonfb 34. carsonfb Lv 1 3 pts. 33,470
  5. Avatar for maithra 35. maithra Lv 1 2 pts. 33,462
  6. Avatar for ecali 36. ecali Lv 1 2 pts. 33,441
  7. Avatar for hansvandenhof 37. hansvandenhof Lv 1 2 pts. 33,176
  8. Avatar for Larini 38. Larini Lv 1 2 pts. 33,134
  9. Avatar for Trajan464 39. Trajan464 Lv 1 1 pt. 33,099
  10. Avatar for blazegeek 40. blazegeek Lv 1 1 pt. 33,034

Comments