Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 35,454
  2. Avatar for Go Science 2. Go Science 60 pts. 35,273
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 35,056
  4. Avatar for Contenders 4. Contenders 17 pts. 34,974
  5. Avatar for Marvin's bunch 5. Marvin's bunch 8 pts. 34,860
  6. Avatar for Gargleblasters 6. Gargleblasters 4 pts. 34,444
  7. Avatar for Australia 7. Australia 2 pts. 34,413
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 34,385
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 33,479
  10. Avatar for VeFold 10. VeFold 1 pt. 31,152
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 42 pts. 35,056
  2. Avatar for Aubade01 12. Aubade01 Lv 1 38 pts. 35,043
  3. Avatar for Steven Pletsch 13. Steven Pletsch Lv 1 35 pts. 34,999
  4. Avatar for MicElephant 14. MicElephant Lv 1 31 pts. 34,974
  5. Avatar for BackBuffer 15. BackBuffer Lv 1 28 pts. 34,923
  6. Avatar for fpc 16. fpc Lv 1 26 pts. 34,860
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 23 pts. 34,810
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 21 pts. 34,694
  9. Avatar for Joanna_H 19. Joanna_H Lv 1 19 pts. 34,444
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 17 pts. 34,413

Comments