Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 35,454
  2. Avatar for Go Science 2. Go Science 60 pts. 35,273
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 35,056
  4. Avatar for Contenders 4. Contenders 17 pts. 34,974
  5. Avatar for Marvin's bunch 5. Marvin's bunch 8 pts. 34,860
  6. Avatar for Gargleblasters 6. Gargleblasters 4 pts. 34,444
  7. Avatar for Australia 7. Australia 2 pts. 34,413
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 34,385
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 33,479
  10. Avatar for VeFold 10. VeFold 1 pt. 31,152
  1. Avatar for argyrw 41. argyrw Lv 1 1 pt. 33,023
  2. Avatar for ProfVince 42. ProfVince Lv 1 1 pt. 33,012
  3. Avatar for Hexafluorouranate 43. Hexafluorouranate Lv 1 1 pt. 32,968
  4. Avatar for Oransche 44. Oransche Lv 1 1 pt. 32,363
  5. Avatar for zbp 45. zbp Lv 1 1 pt. 32,321
  6. Avatar for Opelgang 46. Opelgang Lv 1 1 pt. 32,156
  7. Avatar for jtwolff 47. jtwolff Lv 1 1 pt. 31,759
  8. Avatar for DScott 48. DScott Lv 1 1 pt. 31,582
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 31,389
  10. Avatar for Arne Heessels 50. Arne Heessels Lv 1 1 pt. 31,165

Comments