Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,624
  2. Avatar for Go Science 2. Go Science 65 pts. 12,624
  3. Avatar for Contenders 3. Contenders 41 pts. 12,594
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,575
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 12,555
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 12,530
  7. Avatar for Australia 7. Australia 4 pts. 12,527
  8. Avatar for VeFold 8. VeFold 2 pts. 12,493
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 12,474
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 12,339

  1. Avatar for DScott 51. DScott Lv 1 1 pt. 12,110
  2. Avatar for Deleted player 52. Deleted player 1 pt. 12,105
  3. Avatar for rinze 53. rinze Lv 1 1 pt. 12,090
  4. Avatar for Quantum_Mareness 54. Quantum_Mareness Lv 1 1 pt. 12,084
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 1 pt. 12,062
  6. Avatar for jdmclure 56. jdmclure Lv 1 1 pt. 11,918
  7. Avatar for argyrw 57. argyrw Lv 1 1 pt. 11,914
  8. Avatar for mart0258 58. mart0258 Lv 1 1 pt. 11,888
  9. Avatar for furi0us 59. furi0us Lv 1 1 pt. 11,836
  10. Avatar for ece_cinar 60. ece_cinar Lv 1 1 pt. 11,644

Comments