Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,624
  2. Avatar for Go Science 2. Go Science 65 pts. 12,624
  3. Avatar for Contenders 3. Contenders 41 pts. 12,594
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,575
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 12,555
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 12,530
  7. Avatar for Australia 7. Australia 4 pts. 12,527
  8. Avatar for VeFold 8. VeFold 2 pts. 12,493
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 12,474
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 12,339
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 12,624
  2. Avatar for grogar7 2. grogar7 Lv 1 93 pts. 12,624
  3. Avatar for LociOiling 3. LociOiling Lv 1 86 pts. 12,619
  4. Avatar for Galaxie 4. Galaxie Lv 1 79 pts. 12,600
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 73 pts. 12,600
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 67 pts. 12,594
  7. Avatar for MicElephant 7. MicElephant Lv 1 61 pts. 12,593
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 56 pts. 12,591
  9. Avatar for ichwilldiesennamen 9. ichwilldiesennamen Lv 1 51 pts. 12,589
  10. Avatar for gmn 10. gmn Lv 1 47 pts. 12,578

Comments