Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 15,905
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 13,908
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 48 pts. 19,934
  2. Avatar for akaaka 12. akaaka Lv 1 45 pts. 19,927
  3. Avatar for drjr 13. drjr Lv 1 41 pts. 19,918
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 38 pts. 19,902
  5. Avatar for ichwilldiesennamen 15. ichwilldiesennamen Lv 1 35 pts. 19,894
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 32 pts. 19,888
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 30 pts. 19,884
  8. Avatar for blazegeek 18. blazegeek Lv 1 27 pts. 19,876
  9. Avatar for grogar7 19. grogar7 Lv 1 25 pts. 19,863
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 23 pts. 19,856

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891