Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 20,026
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 20,019
  3. Avatar for Go Science 3. Go Science 37 pts. 20,015
  4. Avatar for Contenders 4. Contenders 21 pts. 20,008
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 19,974
  6. Avatar for Australia 6. Australia 5 pts. 19,856
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 19,800
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 19,746
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,657
  10. Avatar for VeFold 10. VeFold 1 pt. 19,547
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 20,026
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 94 pts. 20,019
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 88 pts. 20,012
  4. Avatar for MicElephant 4. MicElephant Lv 1 82 pts. 20,008
  5. Avatar for Galaxie 5. Galaxie Lv 1 76 pts. 20,003
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 71 pts. 20,002
  7. Avatar for Aubade01 7. Aubade01 Lv 1 66 pts. 19,980
  8. Avatar for fpc 8. fpc Lv 1 61 pts. 19,974
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 56 pts. 19,962
  10. Avatar for gmn 10. gmn Lv 1 52 pts. 19,955

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891