Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 15,905
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 13,908
  1. Avatar for ProfVince 41. ProfVince Lv 1 2 pts. 19,416
  2. Avatar for kitsoune 42. kitsoune Lv 1 2 pts. 19,402
  3. Avatar for Oransche 43. Oransche Lv 1 2 pts. 19,310
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 2 pts. 19,198
  5. Avatar for Deleted player 45. Deleted player 1 pt. 19,171
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 19,115
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 19,106
  8. Avatar for Kevonni 48. Kevonni Lv 1 1 pt. 18,972
  9. Avatar for carsonfb 49. carsonfb Lv 1 1 pt. 18,902
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 18,803

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891