Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 15,905
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 13,908
  1. Avatar for furi0us 61. furi0us Lv 1 1 pt. 14,829
  2. Avatar for carxo 62. carxo Lv 1 1 pt. 13,964
  3. Avatar for Betul Yiyen 63. Betul Yiyen Lv 1 1 pt. 13,908
  4. Avatar for Francisco 64. Francisco Lv 1 1 pt. 13,865
  5. Avatar for e235439 65. e235439 Lv 1 1 pt. 13,864
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 13,738
  7. Avatar for pfirth 67. pfirth Lv 1 1 pt. 13,695
  8. Avatar for zbp 68. zbp Lv 1 1 pt. 12,963
  9. Avatar for genceryaprak 69. genceryaprak Lv 1 1 pt. 12,846
  10. Avatar for anna.g4 70. anna.g4 Lv 1 1 pt. 0

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891