Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 15,905
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 13,908
  1. Avatar for iboy 71. iboy Lv 1 1 pt. 0
  2. Avatar for p127 72. p127 Lv 1 1 pt. 0
  3. Avatar for Cerani 73. Cerani Lv 1 1 pt. 0
  4. Avatar for spvincent 74. spvincent Lv 1 1 pt. 0

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891