Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,026
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 20,019
  3. Avatar for Go Science 3. Go Science 37 pts. 20,015
  4. Avatar for Contenders 4. Contenders 21 pts. 20,008
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 19,974
  6. Avatar for Australia 6. Australia 5 pts. 19,856
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 19,800
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 19,746
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,657
  10. Avatar for VeFold 10. VeFold 1 pt. 19,547

  1. Avatar for Steven Pletsch 21. Steven Pletsch Lv 1 21 pts. 19,855
  2. Avatar for g_b 22. g_b Lv 1 19 pts. 19,852
  3. Avatar for guineapig 23. guineapig Lv 1 17 pts. 19,841
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 16 pts. 19,800
  5. Avatar for Joanna_H 25. Joanna_H Lv 1 14 pts. 19,746
  6. Avatar for phi16 26. phi16 Lv 1 13 pts. 19,746
  7. Avatar for alcor29 27. alcor29 Lv 1 12 pts. 19,728
  8. Avatar for Finn2400 28. Finn2400 Lv 1 10 pts. 19,715
  9. Avatar for NPrincipi 29. NPrincipi Lv 1 9 pts. 19,688
  10. Avatar for georg137 30. georg137 Lv 1 8 pts. 19,680

Comments


LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891