Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,026
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 20,019
  3. Avatar for Go Science 3. Go Science 37 pts. 20,015
  4. Avatar for Contenders 4. Contenders 21 pts. 20,008
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 19,974
  6. Avatar for Australia 6. Australia 5 pts. 19,856
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 19,800
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 19,746
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,657
  10. Avatar for VeFold 10. VeFold 1 pt. 19,547

  1. Avatar for ProfVince 41. ProfVince Lv 1 2 pts. 19,416
  2. Avatar for kitsoune 42. kitsoune Lv 1 2 pts. 19,402
  3. Avatar for Oransche 43. Oransche Lv 1 2 pts. 19,310
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 2 pts. 19,198
  5. Avatar for Deleted player 45. Deleted player 1 pt. 19,171
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 19,115
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 19,106
  8. Avatar for Kevonni 48. Kevonni Lv 1 1 pt. 18,972
  9. Avatar for carsonfb 49. carsonfb Lv 1 1 pt. 18,902
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 18,803

Comments


LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891