Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,026
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 20,019
  3. Avatar for Go Science 3. Go Science 37 pts. 20,015
  4. Avatar for Contenders 4. Contenders 21 pts. 20,008
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 19,974
  6. Avatar for Australia 6. Australia 5 pts. 19,856
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 19,800
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 19,746
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,657
  10. Avatar for VeFold 10. VeFold 1 pt. 19,547

  1. Avatar for rosie4loop 51. rosie4loop Lv 1 1 pt. 18,672
  2. Avatar for argyrw 52. argyrw Lv 1 1 pt. 18,573
  3. Avatar for Uniursh 53. Uniursh Lv 1 1 pt. 18,389
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 17,437
  5. Avatar for Larini 55. Larini Lv 1 1 pt. 17,246
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 15,997
  7. Avatar for Simek 57. Simek Lv 1 1 pt. 15,905
  8. Avatar for jdmclure 58. jdmclure Lv 1 1 pt. 15,869
  9. Avatar for pruneau_44 59. pruneau_44 Lv 1 1 pt. 15,527
  10. Avatar for DScott 60. DScott Lv 1 1 pt. 15,144

Comments


LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891