Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,026
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 20,019
  3. Avatar for Go Science 3. Go Science 37 pts. 20,015
  4. Avatar for Contenders 4. Contenders 21 pts. 20,008
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 19,974
  6. Avatar for Australia 6. Australia 5 pts. 19,856
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 19,800
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 19,746
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,657
  10. Avatar for VeFold 10. VeFold 1 pt. 19,547

  1. Avatar for iboy 71. iboy Lv 1 1 pt. 0
  2. Avatar for p127 72. p127 Lv 1 1 pt. 0
  3. Avatar for Cerani 73. Cerani Lv 1 1 pt. 0
  4. Avatar for spvincent 74. spvincent Lv 1 1 pt. 0

Comments


LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891