Placeholder image of a protein
Icon representing a puzzle

2400: Electron Density Reconstruction 72

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 19, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's one chain in this protein, but not all the segments may be visible.

Sequence
MSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQKLQENLKKAKEKEAENHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 20,026
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 20,019
  3. Avatar for Go Science 3. Go Science 37 pts. 20,015
  4. Avatar for Contenders 4. Contenders 21 pts. 20,008
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 19,974
  6. Avatar for Australia 6. Australia 5 pts. 19,856
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 19,800
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 19,746
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 19,657
  10. Avatar for VeFold 10. VeFold 1 pt. 19,547
  1. Avatar for ShadowTactics 31. ShadowTactics Lv 1 8 pts. 19,657
  2. Avatar for rjsthethird 32. rjsthethird Lv 1 7 pts. 19,651
  3. Avatar for manu8170 33. manu8170 Lv 1 6 pts. 19,648
  4. Avatar for Trajan464 34. Trajan464 Lv 1 5 pts. 19,626
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 5 pts. 19,612
  6. Avatar for dcrwheeler 36. dcrwheeler Lv 1 4 pts. 19,602
  7. Avatar for muffnerk 37. muffnerk Lv 1 4 pts. 19,550
  8. Avatar for Tian00 38. Tian00 Lv 1 3 pts. 19,547
  9. Avatar for silent gene 39. silent gene Lv 1 3 pts. 19,447
  10. Avatar for Vinara 40. Vinara Lv 1 3 pts. 19,428

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC1
2400: Electron Density Reconstruction 72
1  pucker found!
pucker 1 (ideality), segments 55-56 (protein), distance = 8.004, ideality = -26205.963, -26201.891