Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,101
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,962
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,817
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 8,697
  1. Avatar for Arne Heessels 41. Arne Heessels Lv 1 4 pts. 9,078
  2. Avatar for Deleted player 42. Deleted player 3 pts. 9,069
  3. Avatar for carsonfb 43. carsonfb Lv 1 3 pts. 9,019
  4. Avatar for pfirth 44. pfirth Lv 1 3 pts. 9,018
  5. Avatar for Hillbillie 45. Hillbillie Lv 1 2 pts. 9,012
  6. Avatar for GenGF 46. GenGF Lv 1 2 pts. 8,962
  7. Avatar for Trajan464 47. Trajan464 Lv 1 2 pts. 8,933
  8. Avatar for DScott 48. DScott Lv 1 2 pts. 8,924
  9. Avatar for kitsoune 49. kitsoune Lv 1 2 pts. 8,910
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 8,883

Comments