Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,101
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,962
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,817
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 8,697
  1. Avatar for Uniursh 61. Uniursh Lv 1 1 pt. 8,415
  2. Avatar for argyrw 62. argyrw Lv 1 1 pt. 8,330
  3. Avatar for mellis 63. mellis Lv 1 1 pt. 8,329
  4. Avatar for BrittanyBird 64. BrittanyBird Lv 1 1 pt. 8,027
  5. Avatar for jdmclure 65. jdmclure Lv 1 1 pt. 7,979
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 7,801
  7. Avatar for pruneau_44 67. pruneau_44 Lv 1 1 pt. 7,753
  8. Avatar for awalker3 68. awalker3 Lv 1 1 pt. 7,718
  9. Avatar for anastasiia93 69. anastasiia93 Lv 1 1 pt. 7,608
  10. Avatar for yfu005 70. yfu005 Lv 1 1 pt. 7,599

Comments