Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,101
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,962
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,817
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 8,697
  1. Avatar for Betul Yiyen 71. Betul Yiyen Lv 1 1 pt. 7,574
  2. Avatar for kristupas 72. kristupas Lv 1 1 pt. 7,565
  3. Avatar for screenager 73. screenager Lv 1 1 pt. 7,460
  4. Avatar for genceryaprak 74. genceryaprak Lv 1 1 pt. 7,363
  5. Avatar for osc 75. osc Lv 1 1 pt. 7,353
  6. Avatar for furi0us 76. furi0us Lv 1 1 pt. 7,332
  7. Avatar for Steven Pletsch 77. Steven Pletsch Lv 1 1 pt. 6,652
  8. Avatar for Deleted player 78. Deleted player pts. 6,038
  9. Avatar for sdvaughan99 79. sdvaughan99 Lv 1 1 pt. 5,821
  10. Avatar for tho_bng 80. tho_bng Lv 1 1 pt. 5,785

Comments