Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 26,615
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 21,509

  1. Avatar for Oransche 41. Oransche Lv 1 1 pt. 27,520
  2. Avatar for Vinara 42. Vinara Lv 1 1 pt. 27,500
  3. Avatar for Deleted player 43. Deleted player 1 pt. 27,485
  4. Avatar for Arne Heessels 44. Arne Heessels Lv 1 1 pt. 27,452
  5. Avatar for Trajan464 45. Trajan464 Lv 1 1 pt. 27,413
  6. Avatar for Merf 46. Merf Lv 1 1 pt. 27,304
  7. Avatar for DScott 47. DScott Lv 1 1 pt. 27,279
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 1 pt. 27,260
  9. Avatar for kitsoune 49. kitsoune Lv 1 1 pt. 27,061
  10. Avatar for evifnoskcaj 50. evifnoskcaj Lv 1 1 pt. 27,022

Comments