Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 26,615
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 21,509
  1. Avatar for pizpot 51. pizpot Lv 1 1 pt. 26,987
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 26,980
  3. Avatar for Hillbillie 53. Hillbillie Lv 1 1 pt. 26,959
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 26,680
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 26,657
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 26,641
  7. Avatar for Hellcat6 57. Hellcat6 Lv 1 1 pt. 26,618
  8. Avatar for e235439 58. e235439 Lv 1 1 pt. 26,615
  9. Avatar for pruneau_44 59. pruneau_44 Lv 1 1 pt. 26,580
  10. Avatar for mart0258 60. mart0258 Lv 1 1 pt. 26,560

Comments