Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 26,615
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 21,509

  1. Avatar for 2417947 61. 2417947 Lv 1 1 pt. 26,558
  2. Avatar for furi0us 62. furi0us Lv 1 1 pt. 25,685
  3. Avatar for abiogenesis 63. abiogenesis Lv 1 1 pt. 24,779
  4. Avatar for xtek23x 65. xtek23x Lv 1 1 pt. 21,509
  5. Avatar for CP 66. CP Lv 1 1 pt. 20,902

Comments