Icon representing a puzzle

2405: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,018
  2. Avatar for Go Science 2. Go Science 73 pts. 11,782
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,557
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 11,518
  5. Avatar for Contenders 5. Contenders 24 pts. 11,487
  6. Avatar for Australia 6. Australia 16 pts. 11,460
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 10 pts. 11,428
  8. Avatar for VeFold 8. VeFold 6 pts. 11,326
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 11,271
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 11,139
  1. Avatar for darkSTORM 91. darkSTORM Lv 1 1 pt. 8,540
  2. Avatar for Rithvik_S_24 92. Rithvik_S_24 Lv 1 1 pt. 8,535
  3. Avatar for devanshbisht 93. devanshbisht Lv 1 1 pt. 8,475
  4. Avatar for kumarkashyap 94. kumarkashyap Lv 1 1 pt. 8,469
  5. Avatar for jflat06 95. jflat06 Lv 1 1 pt. 8,438
  6. Avatar for Sharma01 96. Sharma01 Lv 1 1 pt. 8,438
  7. Avatar for Deleted player 97. Deleted player 1 pt. 8,438
  8. Avatar for aurascoper 98. aurascoper Lv 1 1 pt. 8,438

Comments

LociOiling Lv 1

The expiration time of the this puzzle keeps on slippin', slippin' into the future. Now it expires at the same time as CACHE puzzle 2407, Friday here in the US.

Not clear why this is happening, but what else is new?