Icon representing a puzzle

2405: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,018
  2. Avatar for Go Science 2. Go Science 73 pts. 11,782
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,557
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 11,518
  5. Avatar for Contenders 5. Contenders 24 pts. 11,487
  6. Avatar for Australia 6. Australia 16 pts. 11,460
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 10 pts. 11,428
  8. Avatar for VeFold 8. VeFold 6 pts. 11,326
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 11,271
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 11,139
  1. Avatar for pfirth 81. pfirth Lv 1 1 pt. 10,012
  2. Avatar for furi0us 82. furi0us Lv 1 1 pt. 9,965
  3. Avatar for karansachan 83. karansachan Lv 1 1 pt. 9,937
  4. Avatar for atharva 84. atharva Lv 1 1 pt. 9,919
  5. Avatar for Deleted player 85. Deleted player 1 pt. 9,827
  6. Avatar for DipsyDoodle2016 86. DipsyDoodle2016 Lv 1 1 pt. 9,714
  7. Avatar for YashrajVala 87. YashrajVala Lv 1 1 pt. 9,484
  8. Avatar for Raket08 88. Raket08 Lv 1 1 pt. 9,257
  9. Avatar for ShivamRaj420 89. ShivamRaj420 Lv 1 1 pt. 9,214
  10. Avatar for kauswhynot 90. kauswhynot Lv 1 1 pt. 9,096

Comments

LociOiling Lv 1

The expiration time of the this puzzle keeps on slippin', slippin' into the future. Now it expires at the same time as CACHE puzzle 2407, Friday here in the US.

Not clear why this is happening, but what else is new?