Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,635
  2. Avatar for Go Science 2. Go Science 63 pts. 21,632
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 21,578
  4. Avatar for Contenders 4. Contenders 21 pts. 21,557
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 21,530
  6. Avatar for Australia 6. Australia 5 pts. 21,464
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 21,397
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 21,341
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,118
  10. Avatar for VeFold 10. VeFold 1 pt. 21,047

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 21,635
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 93 pts. 21,631
  3. Avatar for LociOiling 3. LociOiling Lv 1 86 pts. 21,631
  4. Avatar for Galaxie 4. Galaxie Lv 1 80 pts. 21,629
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 74 pts. 21,629
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 68 pts. 21,621
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 63 pts. 21,580
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 58 pts. 21,578
  9. Avatar for silent gene 9. silent gene Lv 1 53 pts. 21,562
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 49 pts. 21,557

Comments