Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 20,954
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,158

  1. Avatar for roarshock 31. roarshock Lv 1 5 pts. 21,222
  2. Avatar for ShadowTactics 32. ShadowTactics Lv 1 5 pts. 21,118
  3. Avatar for pizpot 33. pizpot Lv 1 4 pts. 21,047
  4. Avatar for hansvandenhof 34. hansvandenhof Lv 1 4 pts. 21,043
  5. Avatar for VU21BTEN0100009 35. VU21BTEN0100009 Lv 1 3 pts. 20,954
  6. Avatar for Idiotboy 36. Idiotboy Lv 1 3 pts. 20,940
  7. Avatar for Trajan464 37. Trajan464 Lv 1 2 pts. 20,916
  8. Avatar for ProfVince 38. ProfVince Lv 1 2 pts. 20,881
  9. Avatar for Oransche 39. Oransche Lv 1 2 pts. 20,850
  10. Avatar for Tian00 40. Tian00 Lv 1 2 pts. 20,842

Comments