Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 20,954
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,158

  1. Avatar for kitsoune 41. kitsoune Lv 1 1 pt. 20,808
  2. Avatar for gurchy 42. gurchy Lv 1 1 pt. 20,808
  3. Avatar for Larini 43. Larini Lv 1 1 pt. 20,798
  4. Avatar for Deleted player 44. Deleted player 1 pt. 20,772
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 1 pt. 20,771
  6. Avatar for carsonfb 46. carsonfb Lv 1 1 pt. 20,751
  7. Avatar for Hexafluorouranate 47. Hexafluorouranate Lv 1 1 pt. 20,740
  8. Avatar for fordesk 48. fordesk Lv 1 1 pt. 20,703
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 20,691
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 20,641

Comments