Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 20,954
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,158
  1. Avatar for VU21BTEN0100033 61. VU21BTEN0100033 Lv 1 1 pt. 20,066
  2. Avatar for furi0us 62. furi0us Lv 1 1 pt. 20,046
  3. Avatar for Belle36 63. Belle36 Lv 1 1 pt. 20,003
  4. Avatar for Avijit Pandey 64. Avijit Pandey Lv 1 1 pt. 18,382
  5. Avatar for drjr 65. drjr Lv 1 1 pt. 17,962
  6. Avatar for Wiz kid 66. Wiz kid Lv 1 1 pt. 16,944
  7. Avatar for rmoretti 67. rmoretti Lv 1 1 pt. 12,158

Comments