Placeholder image of a protein
Icon representing a puzzle

2409: : Electron Density Reconstruction 75

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 19, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but there are some gaps in the visible segments.

Sequence
GSNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,635
  2. Avatar for Go Science 2. Go Science 63 pts. 21,632
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 21,578
  4. Avatar for Contenders 4. Contenders 21 pts. 21,557
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 21,530
  6. Avatar for Australia 6. Australia 5 pts. 21,464
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 21,397
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 21,341
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,118
  10. Avatar for VeFold 10. VeFold 1 pt. 21,047

  1. Avatar for phi16 11. phi16 Lv 1 44 pts. 21,554
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 41 pts. 21,538
  3. Avatar for guineapig 13. guineapig Lv 1 37 pts. 21,532
  4. Avatar for BackBuffer 14. BackBuffer Lv 1 34 pts. 21,531
  5. Avatar for fpc 15. fpc Lv 1 31 pts. 21,530
  6. Avatar for akaaka 16. akaaka Lv 1 28 pts. 21,516
  7. Avatar for blazegeek 17. blazegeek Lv 1 25 pts. 21,514
  8. Avatar for g_b 18. g_b Lv 1 23 pts. 21,504
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 21 pts. 21,503
  10. Avatar for gmn 20. gmn Lv 1 19 pts. 21,502

Comments